Analytical Data
-
Gene name
FSTL1
- Application
-
Alternative Names
FSTL1；FRP;Follistatin-related Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q12841
-
Expression Region
21-308aa
-
AA Sequence
EEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNG KTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDE LRRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKNFDNGDSRLDSSEFLK FVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLK CLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGK NQKGAQTQTEEEMTRYVQELQKHQETAEKTKRVSTKEIHHHHHH
-
Molecular Weight
34 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FSTL1 (Fibroblast Growth Factor-Inducible 14) is a member of the Thrombospondin type-1 repeat-containing protein family and has emerged as a significant research focus due to its role in various physiological and pathological processes. Initially identified as a secreted protein induced by fibroblast growth factor (FGF), FSTL1 is implicated in modulating cell proliferation, differentiation, and survival in response to different stimuli, including tissue injury. Its expression is notably elevated in inflammatory conditions and certain cancers, suggesting a potential involvement in tumor progression and immune regulation. Research has highlighted FSTL1's dual role: it can exert protective effects in conditions such as cardiac injury and inflammatory diseases, while also promoting tumorigenesis in specific contexts. This complexity makes FSTL1 a crucial target for therapeutic strategies aiming to manipulate its signaling pathways for improved outcomes in cardiovascular diseases, cancer, and inflammatory disorders. Moreover, investigations into the biochemical properties and the structural characteristics of FSTL1 recombinant proteins are essential for understanding its functional mechanisms and interactions with other proteins. Overall, the study of FSTL1 offers valuable insights into its potential as a biomarker and therapeutic target, driving ongoing research in molecular biology and translational medicine.
