Analytical Data
-
Gene name
BARF1
- Application
-
Alternative Names
BARF1；Macrophage colony-stimulating factor 1
-
Species
Epstein
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0C6N0
-
Expression Region
21-221aa
-
AA Sequence
VTAFLGERVTLTSYWRRVSLGPEIEVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRSANTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLMPEGVEPAPTAANGGVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGYLSQ
-
Molecular Weight
26.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BARF1, or Bacillus anthracis recombinant protein 1, is a significant focus of research due to its role in the virulence of the bacterium Bacillus anthracis, the causative agent of anthrax. Understanding BARF1 is crucial because it encodes a protein that may modulate immune responses and contribute to the bacterium's ability to evade host defenses. Studies have shown that BARF1 can interfere with host cell apoptosis and facilitate immune evasion, making it a potential target for therapeutic interventions. Furthermore, BARF1's unique properties and its ability to influence various cellular pathways make it a compelling subject for vaccine development and diagnostic assays. Current research aims to elucidate its structural characteristics, understand its function in pathogenicity, and explore its potential applications in biotechnology and medicine. Given the public health implications of anthrax, continued exploration of BARF1 could lead to the development of novel strategies to combat infections caused by Bacillus anthracis.
