Cat: PA1000-1160

Recombinant Human FUCA2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FUCA2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FUCA2;Plasma alpha-L-fucosidase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BTY2

  • Expression Region

    29-467aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSHSATRFDPTWESLDARQLPAWFDQAKF GIFIHWGVFSVPSFGSEWFWWYWQKEKIPKYVEFMKDNYPPSFKYEDFGP LFTAKFFNANQWADIFQASGAKYIVLTSKHHEGFTLWGSEYSWNWNAIDE GPKRDIVKELEVAIRNRTDLRFGLYYSLFEWFHPLFLEDESSSFHKRQFP VSKTLPELYELVNNYQPEVLWSDGDGGAPDQYWNSTGFLAWLYNESPVRG TVVTNDRWGAGSICKHGGFYTCSDRYNPGHLLPHKWENCMTIDKLSWGYR REAGISDYLTIEELVKQLVETVSCGGNLLMNIGPTLDGTISVVFEERLRQ MGSWLKVNGEAIYETHTWRSQNDTVTPDVWYTSKPKEKLVYAIFLKWPTS GQLFLGHPKAILGATEVKLLGHGQPLNWISLEQNGIMVELPQLTIHQMPC KWGWALALTNVI

  • Molecular Weight

    53 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FUCA2, or fucosidase alpha-L-2, is an enzyme implicated in the metabolism of fucose, a carbohydrate that plays essential roles in various biological processes, including cell signaling, adhesion, and immune response. The interest in FUCA2 is particularly heightened due to its association with several pathological conditions, including cancer and genetic disorders like fucosidosis. The study of FUCA2 recombinant proteins has become increasingly relevant as researchers seek to understand the enzyme's structure-function relationship and its role in glycosylation pathways. This understanding could pave the way for novel therapeutic strategies targeting fucose-related pathways. Moreover, the development of FUCA2 recombinant proteins provides tools for studying enzyme kinetics, substrate specificity, and potential inhibitors, thereby contributing to the broader field of glycomics and its applications in medicine. Through techniques such as site-directed mutagenesis, protein engineering, and crystallization, researchers aim to elucidate the mechanisms by which FUCA2 exerts its biological effects. Overall, the exploration of FUCA2 and its recombinant counterparts holds promise for enhancing our knowledge of glycan biology and advancing therapeutic approaches for diseases linked to fucosylation anomalies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US