Cat: IPD-X12392

Recombinant Human IFN-gamma R1/CD119 Protein(HEK293), C-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IFN-gamma R1/CD119

  • 简介

    IFN-gamma R1 (CD119), one of the subunit of IFN-gamma receptor, is a receptor for IFN-gamma. IFN-gamma R1 forms the functional receptor with IFN-gamma R2. Upon binding with IFN-gamma,IFN-gamma R1 and IFN-gamma R2 oligomerize and transphosphorylate[1]. Then, JAK1 and JAK2 are phosphorylated and activated, and STAT1 is recruited to the receptor complex. Phosphorylated STAT1 translocates to the nucleus, where it regulates the expression of IFN-responsive genes (e.g. CD54)[2]. IFN-gamma R1/CD119 Protein, Human (HEK293, His, solution) is a recombinant human IFN-gamma R1 (E18-G245) with C-terminal 6*His tag, which is produced in HEK293 cells.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Interferon gamma receptor 1; IFN-gamma-R1; IFN-gamma-R-alpha; CD119; Ifngr1

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P15260-1

  • Expression Region

    E18-G245

  • AA Sequence

    EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    40-50 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IFN-gamma receptor 1 (IFN-gamma R1 or CD119) plays a crucial role in the immune response by mediating the effects of interferon-gamma (IFN-γ), a key cytokine involved in the regulation of immune functions, particularly in activating macrophages and promoting Th1 responses. The binding of IFN-γ to its receptor induces a signaling cascade that activates several pathways leading to the expression of genes important for pathogen clearance and immune regulation. Due to its significant role in immunity, CD119 is a critical target for research in various fields, including infectious diseases, cancer therapy, and autoimmune disorders. Recombinant proteins of IFN-gamma R1 are produced for various purposes, including elucidating the receptor's structural characteristics, understanding its signaling mechanisms, and developing therapeutic strategies. Studies involving the recombinant form help investigate the receptor's interaction with its ligand and other proteins, enabling the identification of novel therapeutic targets. Additionally, the recombinant protein can be used in vaccine development and diagnostic assays, enhancing our understanding of immune responses in health and disease. Overall, the research surrounding IFN-gamma R1/CD119 recombinant protein is vital for advancing our knowledge of immune regulation and developing targeted treatments to modulate the immune system effectively.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US