Analytical Data
-
Gene name
HLA-DPB1
- Application
-
Alternative Names
beta1 domain MHC class II HLA DPB; class II histocompatibility antigen; DP(W4) beta chain; class II HLA beta chain; DP beta 1 chain; DP(W4) beta chain; DPB1; DPB1_HUMAN; HLA class II histocompatibility antigen; HLA class II histocompatibility antigen; DP beta 1 chain; HLA class II histocompatibility antigen; DP(W4) beta chain; HLA DP14-beta chain; HLA-DP; HLA-DP histocompatibility type; beta-1 subunit; HLA-DP1B; HLA-DPB; HLA-DPB1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P04440
-
Expression Region
30-223aa
-
AA Sequence
RATPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSAR
-
Molecular Weight
26.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HLA-DPB1 is a critical component of the human major histocompatibility complex (MHC) class II molecules, which play a significant role in the immune response by presenting peptide antigens to CD4+ T helper cells. Variations in the HLA-DPB1 gene have been associated with susceptibility to various diseases, including autoimmune disorders, infections, and cancers. Research into HLA-DPB1 recombinant proteins has gained traction as it can facilitate the understanding of the intricate mechanisms by which this molecule influences immune responses. These recombinant proteins can be utilized in studies to elucidate the binding specificity of different peptide antigens, the structural characteristics of HLA-DPB1, and its interactions with T cell receptors, which are crucial for the development of targeted immunotherapies and vaccines. Additionally, generating HLA-DPB1 proteins in vitro allows for the investigation of polymorphic variants and their functional implications in disease, thus contributing to personalized medicine approaches. By exploring the biochemical properties of HLA-DPB1 recombinant proteins, researchers aim to unravel the complexities of immune system regulation and its potential therapeutic applications.
