Analytical Data
-
Gene name
hmw3
- Application
-
Alternative Names
hmw3；Cytadherence high molecular weight Protein 3
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q50360
-
Expression Region
160-339aa
-
AA Sequence
PVVDPDATPEQQADQLFGLDPLPQAPDEYQDTTAPPAYDQTFDQATYDQQAYDQNYDPNAYYDQQAYDQSFDQQAYDQAYDANAYNTQNYDQAHDPNAYYDSQAYSDPDQASAVAPIEVAPLQPEPVAPVVEPTAVPIVESAPIVEVTPTVEPTPTPVVETAPVVEAPKVVEPTPTPVVE
-
Molecular Weight
27.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HMW3 (High Molecular Weight 3) recombinant protein has gained significant attention in recent years due to its potential applications in various fields, including medicine, biotechnology, and materials science. HMW3 is known for its unique structural and functional properties, which are derived from its specific amino acid sequence and high molecular weight. Researchers are particularly interested in its role in the formation and stabilization of protein structures, which can be vital for the development of new therapeutic agents. The ability to produce HMW3 as a recombinant protein allows for more controlled studies of its properties and biological functions, facilitating advancements in our understanding of its mechanisms. Furthermore, this approach opens avenues for engineering HMW3 for enhanced stability and functionality, making it a promising candidate for drug delivery systems and biomaterials. As the demand for innovative solutions in healthcare and environmental sustainability grows, the study of HMW3 recombinant protein continues to expand, with ongoing research focused on optimizing production methods and exploring its interactions at the molecular level. This growing body of work highlights the importance of HMW3 in advancing both fundamental research and practical applications, paving the way for novel biotechnological developments.
