Analytical Data
-
Gene name
HLA-DQB2
- Application
-
Alternative Names
HLA-DQB2; HLA-DXBHLA class II histocompatibility antigen; DQ beta 2 chain; HLA class II histocompatibility antigen; DX beta chain; MHC class II antigen DQB2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P05538
-
Expression Region
1-231aa
-
AA Sequence
MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIYNREEYGRFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVQWFRNDQEETAGVVSTSLIRNGDWTFQILVMLEITPQRGDIYTCQVEHPSLQSPITVEWRPRGPPPAGLLH
-
Molecular Weight
51.15 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HLA-DQB2 is a critical component of the human immune system, specifically part of the Major Histocompatibility Complex (MHC) class II molecules. These molecules play a vital role in the presentation of peptides derived from extracellular proteins to CD4+ T cells, thus activating the adaptive immune response. Understanding HLA-DQB2 is particularly significant due to its association with various autoimmune diseases and its implications in transplant immunology and personalized medicine. Research has shown that certain alleles of HLA-DQB2 are linked to increased susceptibility to conditions such as Type 1 diabetes, celiac disease, and multiple sclerosis, highlighting its importance in disease predisposition and immunological responses. As a result, the characterization and functional analysis of HLA-DQB2 recombinant proteins have gained attention. Scientists aim to produce these proteins to study their structure, function, and interactions with peptides and immune cells, thereby advancing our understanding of immune mechanisms and potentially aiding in the development of targeted therapies. Through techniques such as recombinant DNA technology, researchers can express HLA-DQB2 in various systems, allowing for detailed biochemical and immunological studies. Ultimately, this work may pave the way for the development of novel diagnostic and therapeutic strategies that harness the power of the immune system to better combat autoimmune diseases and improve transplant outcomes.
