Analytical Data
-
Gene name
STE11
- Application
-
Alternative Names
STE11；Serine/threonine-Protein kinase STE11
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P23561
-
Expression Region
415-712aa
-
AA Sequence
WLKGACIGSGSFGSVYLGMNAHTGELMAVKQVEIKNNNIGVPTDNNKQANSDENNEQEEQQEKIEDVGAVSHPKTNQNIHRKMVDALQHEMNLLKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQGSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFTGKHPFPDFSQMQAIFKIGTNTTPEIPSWATSEGKNFLRKAFELDYQYRPSALELLQHPWL
-
Molecular Weight
33.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
STE11 is a significant protein in the signaling pathways of various organisms, particularly in yeast, where it serves as a key component in the pheromone response and filamentous growth pathways. As a member of the MAPK (Mitogen-Activated Protein Kinase) signaling cascade, STE11 acts upstream of several downstream effectors, influencing cell differentiation, proliferation, and stress responses. The study of STE11 recombinant protein is vital for understanding its structural and functional properties, as well as the mechanistic insights into MAPK signaling. This research is particularly relevant due to its implications in developmental biology and potential applications in biotechnology and medicine. Recombinant STE11 can be produced in various expression systems, enabling detailed biochemical assays and structural analyses. By elucidating the specific interactions and regulatory mechanisms involving STE11, researchers hope to uncover novel therapeutic targets for diseases linked to dysregulated MAPK pathways, including cancer and developmental disorders. Understanding STE11 not only contributes to fundamental biology but also enhances our comprehension of the complex signaling networks that govern cellular responses to environmental stimuli.
