Cat: PA2000-4148

Recombinant Human YTHDF1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    YTHDF1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    YTHDF1;C20orf21;YTH domain-containing family Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BYJ9

  • Expression Region

    389-523aa

  • AA Sequence

    GRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKII

  • Molecular Weight

    19.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

YTHDF1 is a member of the YTH family of proteins that specifically bind to N6-methyladenosine (m6A) modifications in RNA, playing a crucial role in post-transcriptional regulation of gene expression. The research background of YTHDF1 is rooted in the growing understanding of the epitranscriptome, a field that explores how modifications to RNA molecules influence their stability, localization, translation, and degradation. m6A methylation is a prevalent and dynamic modification that affects various biological processes, including cellular differentiation, proliferation, and stress response. Studying YTHDF1 is particularly important as it is implicated in several physiological and pathological conditions, such as cancer, obesity, and neurological disorders. By understanding its molecular mechanisms and interactions, researchers aim to elucidate the functional consequences of m6A modification and how YTHDF1 contributes to the regulatory networks within cells. Recombinant YTHDF1 protein is often produced for in vitro studies to examine its RNA binding specificity, binding kinetics, and its role in modulating mRNA translation and decay processes. This research not only enhances our understanding of RNA metabolism but also opens up potential therapeutic avenues for diseases linked to dysregulated m6A signaling. As we delve deeper into the functional roles of YTHDF1 and its interactions with other components of the m6A machinery, it becomes increasingly clear that this protein is central to the intricate regulation of gene expression in diverse biological contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US