Analytical Data
-
Gene name
YTHDF1
- Application
-
Alternative Names
YTHDF1；C20orf21；YTH domain-containing family Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BYJ9
-
Expression Region
389-523aa
-
AA Sequence
GRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKII
-
Molecular Weight
19.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
YTHDF1 is a member of the YTH family of proteins that specifically bind to N6-methyladenosine (m6A) modifications in RNA, playing a crucial role in post-transcriptional regulation of gene expression. The research background of YTHDF1 is rooted in the growing understanding of the epitranscriptome, a field that explores how modifications to RNA molecules influence their stability, localization, translation, and degradation. m6A methylation is a prevalent and dynamic modification that affects various biological processes, including cellular differentiation, proliferation, and stress response. Studying YTHDF1 is particularly important as it is implicated in several physiological and pathological conditions, such as cancer, obesity, and neurological disorders. By understanding its molecular mechanisms and interactions, researchers aim to elucidate the functional consequences of m6A modification and how YTHDF1 contributes to the regulatory networks within cells. Recombinant YTHDF1 protein is often produced for in vitro studies to examine its RNA binding specificity, binding kinetics, and its role in modulating mRNA translation and decay processes. This research not only enhances our understanding of RNA metabolism but also opens up potential therapeutic avenues for diseases linked to dysregulated m6A signaling. As we delve deeper into the functional roles of YTHDF1 and its interactions with other components of the m6A machinery, it becomes increasingly clear that this protein is central to the intricate regulation of gene expression in diverse biological contexts.
