Analytical Data
-
Gene name
HNRNPA0
- Application
-
Alternative Names
Heterogeneous nuclear ribonucleoprotein A0; hnRNA binding protein; hnRNP A0; HNRNPA0; HNRPA0; ROA0_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13151
-
Expression Region
1-305aa
-
AA Sequence
MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGGRDQNGLSKGGGGGYNSYGGYGGGGGGGYNAYGGGGGGSSYGGSDYGNGFGGFGSYSQHQSSYGPMKSGGGGGGGGSSWGGRSNSGPYRGGYGGGGGYGGSSF
-
Molecular Weight
57.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HNRNPA0, or heterogeneous nuclear ribonucleoprotein A0, is a significant protein that plays a critical role in various cellular processes, including pre-mRNA splicing, mRNA stability, and transport. It belongs to a family of heterogeneous nuclear ribonucleoproteins (hnRNPs) that are essential for RNA processing and gene expression regulation. Research on HNRNPA0 has gained traction due to its involvement in key cellular functions and its implications in several diseases, particularly in cancer and neurodegenerative disorders. Disturbances in the expression and function of HNRNPA0 have been associated with alterations in alternative splicing, which can lead to the generation of oncogenic isoforms and other pathogenic alterations. Moreover, HNRNPA0 has been implicated in stress responses, cell proliferation, and differentiation, making it a target for understanding the molecular mechanisms underlying various diseases. The development of recombinant HNRNPA0 proteins for structural and functional studies aims to elucidate its role in RNA biology and its potential as a therapeutic target. Ongoing research is focused on the cooperative interactions of HNRNPA0 with other RNA-binding proteins and its impact on the gene expression landscape, providing insights into the intricate networks governing cellular health and disease progression. As a result, HNRNPA0 serves as an important model for studying the complexities of RNA processing and the consequences of its dysregulation in pathological states.
