Analytical Data
-
Gene name
RANkL
- Application
-
Alternative Names
RANkL；OPGL；RANKL；TRANCE；Tumor necrosis factor ligand superfamily member 11
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14788
-
Expression Region
152-317aa
-
AA Sequence
LDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTF SNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPS SHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDP DQDATYFGAFKVRDID
-
Molecular Weight
18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RANKL (Receptor Activator of Nuclear Factor Kappa-Β Ligand) is a critical protein in the regulation of osteoclastogenesis, the process by which osteoclasts, the cells responsible for bone resorption, are formed. Initially identified as a key factor in bone biology, RANKL is integral to the RANK-RANKL-OPG (Osteoprotegerin) signaling pathway, which plays a pivotal role in maintaining bone homeostasis. Dysregulation of RANKL signaling is associated with various bone disorders, such as osteoporosis, rheumatoid arthritis, and metastatic bone disease. Given its significant role, RANKL has become a focus of therapeutic research aimed at modulating bone resorption. The development and characterization of recombinant RANKL proteins have enabled researchers to explore the molecular mechanisms underlying bone metabolism, assess the therapeutic potential for the treatment of bone-related diseases, and investigate the role of RANKL in immune responses and inflammation. Furthermore, recombinant RANKL is being evaluated for its utility in enhancing bone regeneration in orthopedic and dental applications, providing insight into its dual role in both skeletal health and disease. This growing body of research highlights the importance of RANKL as a therapeutic target, paving the way for novel interventions that aim to restore or enhance bone health in affected individuals. As our understanding of RANKL's multifaceted functions continues to evolve, it underscores the need for ongoing investigations into its mechanistic pathways and potential clinical applications in the context of bone metabolism and beyond.
