Analytical Data
-
Gene name
GPD1L
- Application
-
Alternative Names
GPD1L;KIAA0089;Glycerol-3-phosphate dehydrogenase 1-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N335
-
Expression Region
1-351aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAAAPLKVCIVGSGNWGSAVAKIIGNNVKK LQKFASTVKMWVFEETVNGRKLTDIINNDHENVKYLPGHKLPENVVAMSN LSEAVQDADLLVFVIPHQFIHRICDEITGRVPKKALGITLIKGIDEGPEG LKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKVMENGLLFK ELLQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVI RLGLMEMIAFARIFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFA RTGKTIEELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQI CYESRPVQEMLSCLQSHPEHT
-
Molecular Weight
41 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPD1L (Glycerol-3-Phosphate Dehydrogenase 1-Like) is an enzyme that plays a crucial role in lipid metabolism and energy production within cells. It is primarily involved in the conversion of glycerol-3-phosphate to dihydroxyacetone phosphate, thus participating in the glycerol phosphate shuttle, which is essential for the transport of electrons into the mitochondria for ATP synthesis. Recent studies have highlighted the significance of GPD1L in various physiological processes, including cardiac function and metabolic regulation. Mutations in the GPD1L gene have been associated with cardiac arrhythmias and other cardiovascular diseases, making it a key target for research in understanding the molecular mechanisms underlying these conditions. Additionally, the protein's involvement in the pathophysiology of metabolic disorders has opened avenues for exploring therapeutic interventions that could modulate its activity. The development of recombinant GPD1L proteins for experimental purposes has enabled researchers to investigate the functional properties of this enzyme in greater detail, contributing to our understanding of its role in metabolism and disease. As the global prevalence of metabolic syndromes and cardiovascular issues continues to rise, understanding the function and regulation of GPD1L could potentially yield novel insights into prevention and treatment strategies. Researchers are increasingly focusing on characterizing its biochemical properties, exploring its potential as a biomarker, and investigating the therapeutic implications of modulating its activity in various disease contexts. These efforts aim to unravel the complexities of GPD1L's role within the broader network of metabolic regulation and its potential impact on human health.
