Analytical Data
-
Gene name
GRB2
- Application
-
Alternative Names
GRB2;ASH;Growth factor receptor-bound Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P62993
-
Expression Region
2-217aa
-
AA Sequence
MASMTGGQQMGRGHHHHHHENLYFQGGSEAIAKYDFKATADDELSFKRGD ILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEM LSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVV KFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDG ELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GRB2 (Growth Factor Receptor-Bound Protein 2) is a pivotal adaptor protein that plays a critical role in various cellular processes, including proliferation, differentiation, and survival, primarily by mediating signaling pathways activated by receptor tyrosine kinases. Its structure features an SH2 domain that binds phosphorylated tyrosine residues and two SH3 domains that interact with proline-rich motifs in other proteins, facilitating the assembly of signaling complexes. The dysregulation of GRB2 has been implicated in several diseases, particularly cancer, where it contributes to oncogenic signaling pathways. Therefore, the recombinant expression and purification of GRB2 have garnered significant research interest as a means to elucidate its functional mechanisms and regulatory roles. By producing GRB2 in a recombinant system, researchers can obtain large quantities of the protein for structural studies, functional assays, and drug screening. Additionally, understanding the interaction of GRB2 with its binding partners can unveil potential therapeutic targets for intervention in diseases characterized by disturbed growth factor signaling. Efforts to study GRB2 at the molecular level have the potential to provide insights into its contribution to cellular signaling networks and the pathogenesis of proliferative disorders, thereby enhancing our knowledge of targeted therapies in oncology and beyond.
