Analytical Data
-
Gene name
GHR
- Application
-
Alternative Names
GHR;Growth hormone receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10912
-
Expression Region
27-264aa
-
AA Sequence
AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY
-
Molecular Weight
58.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GHR, or growth hormone receptor, is a crucial component of the growth hormone signaling pathway, playing a vital role in growth, metabolism, and overall development. Research into GHR has gained significant attention due to its implications in various health conditions, including growth disorders, obesity, and diabetes. Understanding the structure and function of GHR is essential for developing targeted therapies, particularly in managing diseases linked to growth hormone dysregulation. Moreover, the exploration of GHR as a recombinant protein has opened avenues for advanced studies in pharmacology and biotechnology. Scientists have focused on the recombinant production of GHR to facilitate functional studies, drug design, and potential therapeutic interventions. The availability of GHR as a recombinant protein allows researchers to investigate its physiological roles and mechanisms of action in greater detail, thereby paving the way for novel insights into its therapeutic potential. This background highlights the importance of GHR research in biomedical science and its relevance to addressing critical health challenges.
