Analytical Data
-
Gene name
HOXC9
- Application
-
Alternative Names
Homeo box C9; Homeobox C9; Homeobox protein Hox C9 ; Homeobox protein Hox-3B; Homeobox protein Hox-C9; Hox 3B; HOX3; HOX3B; Hoxc9; HXC9_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P31274
-
Expression Region
1-260aa
-
AA Sequence
MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDFPSCSFAPKPAVFSTSWAPVPSQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKPDAYPGRRADCGPGEGRSYPDYMYGSPGELRDRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQS
-
Molecular Weight
54.34 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HOXC9, a member of the homeobox gene family, plays a crucial role in limb development and the regulation of various biological processes. It is involved in the transcriptional regulation of many target genes, influencing cell differentiation, proliferation, and embryonic development. The dysregulation of HOXC9 has been implicated in several pathological conditions, including various cancers. Research has shown that HOXC9 can affect tumor growth and metastasis, making it a potential therapeutic target. Consequently, the study of recombinant HOXC9 protein has gained prominence, as it facilitates the elucidation of HOXC9's functional roles and interactions within cellular pathways. Recombinant HOXC9 protein can be utilized in various assays to investigate its molecular mechanisms, including binding affinity to DNA, interaction with other proteins, and impact on gene expression. Understanding the structure and function of HOXC9 through recombinant technology can provide insights into its contribution to developmental biology and disease, revealing new avenues for targeted therapies in cancer and other disorders related to HOXC9 dysfunction.
