Cat: PA1000-1362

Recombinant Human GTF2A1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GTF2A1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GTF2A1;TF2A1;Transcription initiation factor IIA subunit 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P52655

  • Expression Region

    1-274aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMANSANTNTVPKLYRSVIEDVINDVRD IFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQ QQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQ HMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQ PQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQIL FTGNKTQVIPTTVAAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVD

  • Molecular Weight

    32 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GTF2A1, or General Transcription Factor II A, is a crucial protein involved in the initiation of gene transcription by RNA polymerase II. It plays a significant role in the assembly of the transcription machinery at the promoter regions of genes, facilitating the recruitment of other transcription factors and RNA polymerase. Research on the recombinant form of GTF2A1 has gained attention due to its potential implications in understanding various biological processes, including cell growth, differentiation, and response to environmental stimuli. Alterations in GTF2A1 function or expression have been linked to several diseases, particularly certain cancers and developmental disorders. The study of recombinant GTF2A1 allows for the investigation of its biochemical properties, interaction with other transcription factors, and role in gene regulation. Moreover, recombinant proteins serve as valuable tools in drug discovery and development, as they enable the screening of small molecules that can modulate its activity. Overall, the exploration of GTF2A1 and its recombinant forms is essential for elucidating the complexities of transcriptional regulation and its implications for human health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US