Cat: PA2000-4198

Recombinant Human MUC16 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MUC16

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MUC16;CA125;Mucin-16

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8WXI7

  • Expression Region

    9615-9709aa

  • AA Sequence

    VSRTEVMPSSRTSIPGPAQSTMSLDISDEVVTRLSTSPIMTESAEITITT QTGYSLATSQVTLPLGTSMTFLSGTHSTMSQGLSHSEMTNLMSRG

  • Molecular Weight

    36 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MUC16, also known as CA125, is a cell surface glycoprotein that plays a significant role in cancer biology, particularly in ovarian cancer, where it is used as a biomarker for diagnosis and monitoring. The importance of MUC16 lies in its involvement in tumor progression, immune evasion, and cell signaling pathways. Research into recombinant MUC16 protein has gained traction due to its potential applications in immunotherapy and vaccine development. By producing MUC16 in a recombinant form, scientists aim to elucidate its structure-function relationship, enhance understanding of its role in tumor immunology, and develop targeted therapies. This protein exhibits unique properties that make it an attractive candidate for therapeutic targets, particularly given that its overexpression is often correlated with poor prognosis in cancer patients. Studies utilizing recombinant MUC16 have also paved the way for innovative diagnostic tools and personalized medicine approaches, aiming to improve patient outcomes. Understanding the biological activity and interactions of MUC16 can lead to novel strategies for combating cancers that are resistant to conventional therapies, thereby addressing a critical need in oncology research. Overall, the exploration of MUC16 as a recombinant protein continues to be a promising area that may transform the landscape of cancer treatment and management.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US