Cat: PA2000-4200

Recombinant Human sodB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    sodB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    sodB;Superoxide dismutase [Fe]

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0AGD3

  • Expression Region

    1-193aa

  • AA Sequence

    MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSSEGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGKVAEAIAASFGSFADFKAQFTDAAIKNFGSGWTWLVKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYLEHFWALVNWEFVAKNLAA

  • Molecular Weight

    21.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SodB, or superoxide dismutase B, is an essential metalloenzyme that plays a critical role in protecting cells from oxidative stress by catalyzing the dismutation of superoxide radicals into oxygen and hydrogen peroxide. This enzyme is particularly important in various pathogenic bacteria, where it contributes to virulence by enhancing the organism's ability to withstand oxidative damage from the host's immune response. Research on SodB focuses on its structure, function, and potential applications in biotechnology and medicine. Typically found in both aerobic and anaerobic organisms, SodB has different isoforms in various species, each adapted to specific environmental conditions. The study of SodB’s structure has revealed crucial insights into its active site and the mechanisms by which it discriminates between superoxide and other radicals. Investigating the expression and regulation of the sodB gene can provide valuable information about bacterial pathogenicity and resistance mechanisms. Moreover, SodB has garnered interest as a potential therapeutic target for developing novel antibiotics, given its vital role in bacterial survival and pathogenesis. By inhibiting SodB activity, it may be possible to enhance the efficacy of existing antibiotics or develop new treatments against infections caused by multidrug-resistant bacteria. Advances in recombinant DNA technology have allowed for the production of SodB as a recombinant protein, enabling detailed studies of its enzymatic properties and interaction with other cellular components. Thus, research into SodB not only enhances our understanding of bacterial physiology but also opens new avenues for combating microbial infections and addressing public health challenges associated with antibiotic resistance.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US