Analytical Data
-
Gene name
MAGEB2
- Application
-
Alternative Names
MAGEB2；Melanoma-associated antigen B2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15479
-
Expression Region
1-319aa
-
AA Sequence
MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAASSSPAAGIPQEPQRAPTTAAAAAAGVSSTKSKKGAKSHQGEKNASSSQASTSTKSPSEDPLTRKSGSLVQFLLYKYKIKKSVTKGEMLKIVGKRFREHFPEILKKASEGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFPRRKLLMPLLGVIFLNGNSATEEEIWEFLNMLGVYDGEEHSVFGEPWKLITKDLVQEKYLEYKQVPSSDPPRFQFLWGPRAYAETSKMKVLEFLAKVNGTTPCAFPTHYEEALKDEEKAGV
-
Molecular Weight
40.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAGEB2, a member of the MAGE (melanoma antigen gene) family, has garnered significant attention in cancer research due to its potential role as a tumor-associated antigen. These proteins are characterized by their expression in various tumors while being largely absent in normal adult tissues, making them promising candidates for cancer immunotherapy. MAGEB2, specifically, is implicated in various malignancies, including melanoma, lung cancer, and other solid tumors. Its expression is associated with more aggressive disease and poorer prognosis, suggesting it plays a role in tumor progression. The interest in MAGEB2 is further heightened by its ability to elicit a specific immune response, which can serve as a target for vaccine development and T-cell therapies. Investigating the structure and function of the MAGEB2 protein, particularly in relation to its immunogenic properties, may provide insights into designing effective therapeutic strategies. Additionally, understanding the mechanisms regulating MAGEB2 expression and its interaction with other cellular pathways could enhance our knowledge of tumor biology and tumor-immune interactions. Overall, MAGEB2 represents a promising area of research that could lead to innovative approaches in cancer treatment and improved patient outcomes.
