Analytical Data
-
Gene name
cdtC
- Application
-
Alternative Names
cdtC;Cytolethal distending toxin subunit C
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q46670
-
Expression Region
16-181aa
-
AA Sequence
CSSSQDSANNQIDELGKENNSLFTFRNIQSGLMIHNGLHQHGRETIGWEIVPVKTPEEALVTDQSGWIMIRTPNTDQCLGTPDGRNLLKMTCNSTAKKTLFSLIPSTTGAVQIKSVLSGLCFLDSKNSGLSFETGKCIADFKKPFEVVPQSHLWMLNPLNTESPII
-
Molecular Weight
25.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of cdtC recombinant protein is set against the backdrop of increasing recognition of the role of microbial toxins in a variety of human diseases. cdtC, a component of the cytolethal distending toxin (CDT) produced by certain pathogens, particularly some strains of *Campylobacter* and *Helicobacter*, has garnered attention due to its impact on cell cycle regulation and apoptosis in host cells. The mechanism by which cdtC exerts its effects involves the induction of DNA damage, leading to cell cycle arrest and ultimately contributing to the pathogenicity of the producing organisms. Understanding the structure and function of cdtC is crucial for developing therapeutic strategies to mitigate the effects of these toxins. Moreover, recombinant production of cdtC provides a valuable tool for investigating its properties and interactions at a molecular level, enabling researchers to dissect its biochemical pathways and assess its potential as a marker for disease or a target for vaccine development. As antibiotic resistance continues to pose significant challenges in treating bacterial infections, research into the modulation of immune responses by cdtC could pave the way for novel therapeutic approaches. Thus, cdtC recombinant protein represents an important subject of investigation within the broader context of infectious disease research and toxinology.











