Cat: PA2000-4284

Recombinant Human DIP2A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DIP2A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DIP2A;C21orf106;DIP2;KIAA0184;Disco-interacting Protein 2 homolog A

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14689

  • Expression Region

    9-127aa

  • AA Sequence

    EAAPLPAEVRESLAELELELSEGDITQKGYEKKRAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRSDVHTEAVQAALAKYKERKMPMPSKRRSVLVHSS

  • Molecular Weight

    42.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DIP2A, a member of the DIP (Domain of Unknown Function, DUF) family, is a protein that has garnered interest due to its potential roles in various biological processes, including neuronal function and intracellular signaling. Research indicates that DIP2A may be involved in synaptic plasticity and the regulation of neurotransmitter release, making it a candidate for studying neurodevelopmental and neurodegenerative disorders. Preliminary studies have suggested that mutations or dysregulation of DIP2A could contribute to conditions such as autism spectrum disorders and schizophrenia. Additionally, its expression patterns in the brain highlight its importance in neurobiological contexts. Given the intricate relationships between protein dysfunction and disease pathology, recombinant forms of DIP2A are being produced to elucidate its structure-function relationships and biochemical mechanisms. These recombinant proteins are vital for in vitro studies, allowing researchers to dissect the molecular interactions and pathways involving DIP2A. Advances in protein engineering and expression systems have facilitated the generation of high-quality DIP2A proteins, which can be used in various assays to study their functionality and the impact of specific mutations. Understanding DIP2A's role at the molecular level could provide insights into its contributions to neural function and its potential as a therapeutic target, hence driving further research into its biological significance and applications in medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US