Cat: PA2000-203DB

Recombinant Human ARRb2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ARRb2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ARRb2;ARB2;ARR2;Beta-arrestin-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P32121

  • Expression Region

    1-409aa

  • AA Sequence

    MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLK DRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTR LQDRLLRKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAF CAKSLEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHL EASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQY KCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTN LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPH DHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMK DDDYDDQLC

  • Molecular Weight

    73 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ARRb2 (arrhythmogenic right ventricular cardiomyopathy protein 2) is a critical protein implicated in the regulation of cardiac function and the pathophysiology of arrhythmogenic right ventricular cardiomyopathy (ARVC), a genetic heart disease characterized by ventricular arrhythmias and risk of sudden cardiac death. Research into ARRb2 has gained traction as understanding its role can elucidate the molecular mechanisms underpinning ARVC and potentially lead to targeted therapies. The protein is known to be involved in various cellular processes, including cardiac cell signaling, contractility, and apoptosis. Mutations in the ARRb2 gene have been associated with familial cases of ARVC, highlighting its significance in inherited cardiovascular conditions. Recent studies focus on the expression, structure, and function of recombinant ARRb2 proteins to better understand how specific mutations alter its properties and contribute to disease pathology. Employing advanced techniques such as molecular cloning, protein purification, and functional assays, researchers aim to dissect the contributions of ARRb2 to cardiac health and disease. Such insights not only advance our comprehension of ARVC but also pave the way for novel therapeutic strategies, enhancing patient outcomes in those affected by this debilitating condition.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US