Analytical Data
-
Gene name
IGHA1
- Application
-
Alternative Names
IGHA1; Immunoglobulin heavy constant alpha 1; Ig alpha-1 chain C region; Ig alpha-1 chain C region BUR; Ig alpha-1 chain C region TRO
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01876
-
Expression Region
1-500aa
-
AA Sequence
MDWTWSILFLVAAATGAQSQVHLVQSGAEVMSPGASVRVSCKTSGYAFHTYSIIWVRQAPGQGLEWMGWISPSSDNTRFAKKFQGRVTLTTDTSTSTVYMELRSLRSDDTAVYYCARRYCSYSSCQNDYYYYYMDVWGKGTTVTVSSASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPDRDLCGCYSVSSVLSGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQETIDRLAGKPTHVNVSVVMAEVDGTCY
-
Molecular Weight
80.74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IGHA1, or Immunoglobulin A1, is a critical component of the human immune system, primarily found in mucosal areas, such as the gut, respiratory tract, and urogenital tract, where it plays a pivotal role in protecting against pathogens. The recombinant production of IGHA1 has gained significant attention due to its potential applications in therapeutics and diagnostics. Understanding its structure and function is essential for developing treatments for various diseases, including infections and autoimmune disorders. Recent advances in protein engineering and expression systems have enabled the efficient production of IGHA1, facilitating research into its mechanisms of action and interactions with other immune components. The study of IGHA1 as a recombinant protein not only provides insights into its biological functions but also opens avenues for novel vaccine formulations and immunotherapies. Additionally, exploring the glycosylation patterns of IGHA1 can enhance our understanding of its stability and efficacy, as these modifications influence its interactions with receptors and other molecules in the immune system. As a result, research on IGHA1 recombinant protein continues to expand, underscoring its importance in immunology and its potential for clinical applications.
