Analytical Data
-
Gene name
HRASLS3
- Application
-
Alternative Names
PLAAT3;HRASLS3;HREV107;PLA2G16;Phospholipase A and acyltransferase 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P53816
-
Expression Region
12-132aa
-
AA Sequence
DLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVK KELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSE NCEHFVNELRYGVARSDQVRD
-
Molecular Weight
14 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HRASLS3, or HRAS-like suppressor 3, is a member of the RAS (Rat Sarcoma) superfamily of proteins, which play critical roles in various cellular processes, including cell proliferation, differentiation, and survival. Research into HRASLS3 has gained attention due to its potential implications in cancer biology, cellular signaling pathways, and metabolic regulation. Unlike other RAS family members, HRASLS3 has been suggested to possess unique regulatory functions, such as influencing lipid metabolism and acting as a tumor suppressor in certain contexts. Initial studies have indicated that HRASLS3 may interact with key signaling proteins, thereby modulating pathways involved in tumor progression and metastasis. Furthermore, the characterization of HRASLS3’s structure and function could provide insights into its role in disease mechanisms and offer potential therapeutic targets for cancer treatments. The ongoing exploration of HRASLS3 and its biological significance underscores the need for comprehensive studies to elucidate its mechanisms of action, interactions, and potential as a biomarker for innovative cancer therapies.
