Cat: PA2000-289DB

Recombinant Human FLNb Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FLNb

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FLNb;FLN1L;FLN3;TABP;Filamin-B

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O75369

  • Expression Region

    2503-2602aa

  • AA Sequence

    SAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGP TTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP

  • Molecular Weight

    278 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FLNb, or fibulin-5, is an extracellular matrix protein that plays a crucial role in various biological processes, including tissue development, angiogenesis, and cellular signaling. Research on FLNb has gained momentum due to its significant involvement in the structural integrity of elastic fibers and its implications in various pathologies, such as arterial diseases, cancer, and connective tissue disorders. Studies have shown that FLNb contributes to the assembly and stabilization of elastin fibers, which are vital for the elasticity and resilience of connective tissues. Moreover, alterations in FLNb expression and function have been linked to the progression of certain diseases. As a result, characterizing FLNb through recombinant protein techniques has become essential for understanding its function at the molecular level. This research aims to investigate the structural properties, interactions, and biological roles of FLNb in both physiological and pathological contexts, thereby providing insights into its potential as a therapeutic target. Developing recombinant FLNb allows for the exploration of its mechanism of action and potential applications in regenerative medicine and tissue engineering, highlighting the significance of this protein in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US