Analytical Data
-
Gene name
KCNIP2
- Application
-
Alternative Names
A type potassium channel modulatory protein 2; A-type potassium channel modulatory protein 2; Cardiac voltage gated potassium channel modulatory subunit; Cardiac voltage-gated potassium channel modulatory subunit; DKFZp566L1246; KChIP 2; KChIP2; KCIP2_HUMAN; KCNIP 2; Kcnip2; Kv channel interacting protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NS61
-
Expression Region
1-270aa
-
AA Sequence
MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSETLAAPASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDNVI
-
Molecular Weight
57.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KCNIP2, also known as K+ channel interacting protein 2, is a member of the K+ channel interacting protein (KCNIP) family that plays a crucial role in modulating the activity of voltage-gated potassium channels. Its involvement in various physiological processes, such as neuronal excitability, cardiac rhythm regulation, and calcium signaling, has garnered considerable attention in the field of cellular physiology and neurobiology. Abnormalities in KCNIP2 expression or function have been linked to a range of neurological disorders and cardiac diseases, highlighting its potential as a therapeutic target. Recent research has focused on the recombinant expression of KCNIP2 to elucidate its structural and functional properties, allowing for detailed studies on its interactions with potassium channels and other cellular proteins. The production of recombinant KCNIP2 enables researchers to investigate the protein's role in cellular signaling pathways and its potential impact on disease mechanisms. Advances in protein expression techniques, including the use of bacterial, yeast, or mammalian cell systems, have facilitated the generation of sufficient quantities of pure KCNIP2 for biochemical and biophysical characterization. This research not only enhances our understanding of KCNIP2's biological functions but also paves the way for potential drug discovery efforts aimed at modulating its activity in pathological conditions, thereby contributing to the development of novel therapeutic strategies.











