Analytical Data
-
Gene name
SLC31A1
- Application
-
Alternative Names
SLC31A1；COPT1；CTR1；High affinity copper uptake Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15431
-
Expression Region
1-190aa
-
AA Sequence
MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFG FKNVELLFSGLVINTAGEMAGAFVAVFLLAMFYEGLKIARESLLRKSQVS IRYNSMPVPGPNGTILMETHKTVGQQMLSFPHLLQTVLHIIQVVISYFLM LIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC31A1, also known as the high-affinity copper transporter 1 (hCTR1), plays a crucial role in copper homeostasis and cellular uptake of copper ions, which are essential for various biological processes including enzyme function and oxidative stress response. Research into SLC31A1 has gained momentum due to its significant implications in human health and disease. Deficiencies or dysfunctions in this transporter are linked to disorders such as Menkes disease, characterized by copper deficiency, and Wilson's disease, which leads to copper accumulation and toxicity. Additionally, SLC31A1 has garnered attention in the context of cancer, as copper is known to influence tumor progression and angiogenesis. The recombinant expression of SLC31A1 has been pursued to elucidate its mechanistic role and to develop potential therapeutic strategies. By producing the protein in various expression systems, researchers aim to study its structural properties, transport kinetics, and interaction with other cellular components. Understanding the function and regulation of SLC31A1 may provide insights into novel treatment approaches for copper-related disorders and enhance our knowledge of cellular metal ion transport mechanisms. Thus, the investigation of SLC31A1 as a recombinant protein is a vital area of research with broad implications for both basic biology and clinical applications.
