Analytical Data
-
Gene name
HB
- Application
-
Alternative Names
HB；Minor histocompatibility Protein HB-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O97980
-
Expression Region
1-41aa
-
AA Sequence
MEEQPECREEKRGSLHVWKSELVEVEDDVYLRHSSSLTYRL
-
Molecular Weight
4.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of HB (Hepatitis B) recombinant proteins is rooted in the need to combat Hepatitis B virus (HBV) infections, which pose a significant global health challenge, affecting over 250 million people worldwide. HBV is primarily transmitted through blood and bodily fluids, and chronic infection can lead to severe liver diseases, including cirrhosis and hepatocellular carcinoma. Traditional vaccine approaches have proven insufficient in controlling the spread of the virus, prompting researchers to explore innovative strategies. Recombinant protein technology, leveraging genetic engineering, allows for the production of HBV surface antigens, which can be utilized in vaccine development and diagnostic applications. The use of recombinant proteins can enhance immune responses and provide a safer alternative to live-attenuated vaccines. Research in this field focuses on optimizing protein expression systems, improving immunogenicity, and developing effective vaccines that can elicit strong and long-lasting immune protection. Advances in this area aim to not only prevent infections but also contribute to therapeutic interventions, addressing both prophylactic and curative needs in HBV management.
