Analytical Data
-
Gene name
mazE
- Application
-
Alternative Names
mazE；T-cell surface glycoProtein CD1b
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0AE72
-
Expression Region
1-82aa
-
AA Sequence
MIHSSVKRWGNSPAVRIPATLMQALNLNIDDEVKIDLVDGKLIIEPVRKEPVFTLAELVNDITPENLHENIDWGEPKDKEVW
-
Molecular Weight
16.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MazE is a crucial protein that has garnered attention in recent years due to its role as an anti-silencing factor in the regulation of gene expression. Initially discovered in the context of certain bacterial species, MazE functions to inhibit the activity of the MazF toxin, a known RNA endonuclease that can degrade mRNA molecules and thereby halt protein synthesis. The unique interplay between MazE and MazF is essential for maintaining cellular homeostasis, particularly under stress conditions that threaten bacterial survival. Additionally, research has shown that the MazE-MazF system is part of a larger network of toxin-antitoxin (TA) systems found across various organisms, which contribute to processes such as antibiotic resistance, biofilm formation, and persistence. These findings highlight the potential of targeting MazE in the development of novel antimicrobial strategies. As the global threat of antibiotic resistance continues to rise, understanding the mechanisms underlying MazE's regulation and function could lead to innovative approaches for combating resistant bacterial infections. Furthermore, the study of MazE can also provide insights into fundamental cellular processes, such as RNA metabolism and stress response pathways, making it a significant focus for ongoing biological research.
