Analytical Data
-
Gene name
KIRREL2
- Application
-
Alternative Names
FILTRIN ; Kin of IRRE like 2 (Drosophila); Kin of IRRE-like protein 2; Kin of irregular chiasm like 2; Kin of irregular chiasm-like protein 2; KIRR2_HUMAN; KIRREL2; NEPH3 ; Nephrin like 3; nephrin-like gene 1; Nephrin-like protein 3; NLG1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UWL6
-
Expression Region
1-219aa
-
AA Sequence
MLRMRVPALLVLLFCFRGRAGPSPHLLQQPEDLVVLLGEGGAQASLGRRASASFSEQKNLMRIPGSSDGSSSRGPEEEETGSREDRGPIVHTDHSDLVLEEEGTLETKDPTNGYYKVRGVSVSLSLGEAPGGGLFLPPPSPLGPPGTPTFYDFNPHLGMVPPCRLYRARAGYLTTPHPRAFTSYIKPTSFGPPDLAPGTPPFPYAAFPTPSHPRLQTHV
-
Molecular Weight
49.83 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KIRREL2, a member of the nephrin-like protein family, plays a pivotal role in cell adhesion and signaling processes, particularly in the development and maintenance of the kidney's filtration barrier. This protein is a crucial component in the formation of slit diaphragms between podocytes, which are specialized cells that filter blood in the kidneys. Disruptions or mutations in KIRREL2 have been associated with various kidney diseases, highlighting its importance in renal function and overall health. Recent studies have begun to elucidate the structural and functional aspects of KIRREL2, focusing on its interactions with other proteins and its signaling pathways. Recombinant KIRREL2 protein is often produced to investigate these interactions in vitro, allowing researchers to analyze its role in kidney pathophysiology and to explore potential therapeutic applications. Understanding the mechanisms by which KIRREL2 functions may lead to novel strategies for treating kidney-related disorders and enhancing our knowledge of cellular adhesion and signaling in different tissues. As research progresses, KIRREL2 is emerging as a significant target for drug development, further emphasizing the need for high-quality recombinant protein for experimental investigations.
