Analytical Data
-
Gene name
iutA
- Application
-
Alternative Names
iutA;Ferric aerobactin receptor
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P14542
-
Expression Region
26-732aa
-
AA Sequence
QQTDDETFVVSANRSNRTVAEMAQTTWVIENAELEQQIQGGKELKDALAQLIPGLDVSSRSRTNYGMNVRGRPLVVLVDGVRLNSSRTDSRQLDSIDPFNMHHIEVIFGATSLYGGGSTGGLINIVTKKGQPETMMEFEAGTKSGFSSSKDHDERIAGAVSGGNEHISGRLSVAYQKFGGWFDGNGDATLLDNTQTGLQYSDRLDIMGTGTLNIDESRQLQLITQYYKSQGDDDYGLNLGKGFSAIRGTSTPFVSNGLNSDRIPGTDGHLISLQYSDSAFLGQELVGQVYYRDESLRFYPFPTVNANKQVTAFSSSQQDTDQYGMKLTLNSKPMDGWQITWGLDADHERFTSNQMFFDLAQASASGGLNNKKIYTTGRYPSYDITNLAAFLQSGYDINNLFTLNGGVRYQYTENKIDDFIGYAQQRQIGAGKATSADAFWRLSRLRHFLFNAGLLMHITEPQQAWLNFSQGLELPDPGKYYGRGIYGAAVNGHLPLTKSVNVSDSKLEGVKVDSYELGWRFTGNNLRTQIAAYYSISDKSVVANKDLTISVVDDKRRIYGVEGAVDYLIPDTDWSTGVNFNVLKTESKVNGTWQKYDVKTASPSKATAYIGWAPDPWSLRVQSTTSFDVSDAQGYKVDGYTTVDLLGSYQLPVGTLSFSIENLFDRDYTTVWGQRAPLYYSPGYGPASLYDYKGRGRTFGLNYSVLF
-
Molecular Weight
85.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of the iutA gene, which encodes a ferric ion uptake transport protein, is crucial in understanding iron acquisition mechanisms in bacteria, particularly in pathogens such as Escherichia coli. Iron is an essential nutrient for bacterial growth and metabolism, yet it is often limited in available extracellular form due to its low solubility, especially in the presence of host defenses. The iutA gene plays a pivotal role in the synthesis of the outer membrane receptor FhuA, which is involved in the uptake of ferric ions bound to siderophores—specialized molecules that facilitate iron transport. Research on iutA recombinant proteins has gained significance as it can lead to insights into bacterial survival strategies and virulence. By studying the functional properties of iutA and its protein product, scientists aim to develop novel antimicrobial therapies targeting iron acquisition pathways, thereby reducing the pathogenicity of iron-dependent bacteria. Furthermore, the recombinant iutA protein can serve as a valuable tool for immunological studies and vaccine development, contributing to the broader field of infectious disease control. The increasing prevalence of antibiotic resistance among bacterial pathogens emphasizes the urgent need for alternative strategies, making the exploration of iron uptake systems, including iutA, a critical area of ongoing research.











