Analytical Data
-
Gene name
MAGOH
- Application
-
Alternative Names
MAGOH;MAGOHA;Protein mago nashi homolog
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P61326
-
Expression Region
1-146aa
-
AA Sequence
MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI
-
Molecular Weight
44.2kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAGOH is a crucial component of the exon junction complex (EJC), which plays a significant role in mRNA processing, surveillance, and translation. This protein has gained attention in recent years due to its involvement in cellular processes such as gene expression regulation and RNA transport. Research into MAGOH's structure and function has been spurred by its association with various diseases, including cancer and neurodegenerative disorders, where its dysregulation may contribute to disease progression. Particularly, MAGOH has been implicated in the modulation of alternative splicing and nonsense-mediated mRNA decay, which are vital for maintaining cellular homeostasis and response to stress. Scientists aim to explore MAGOH's potential as a therapeutic target, leveraging its pivotal role in post-transcriptional regulation. Understanding its biochemical pathways and interactions with other EJC components may shed light on its contribution to cellular functions and highlight strategies for intervention in diseases where MAGOH expression is altered. This research is crucial not only for fundamental biology but also for developing novel therapeutic approaches that harness the regulatory capabilities of MAGOH and its associated pathways.
