Analytical Data
-
Gene name
Ba71V-126
- Application
-
Alternative Names
Ba71V-126；
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q65194
-
Expression Region
54-183aa
-
AA Sequence
SRKKKAAAAIEEEDIQFINPYQDQQWAEVTPQPGTSKPAGATTASAGKPVTGRPATNRPATNKPVTDNPVTDRLVMATGGPAAAPAAASAHPTEPYTTVTTQNTASQTMSAIENLRQRNTYTHKDLENSL
-
Molecular Weight
17.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Ba71V-126 is a recombinant protein derived from the Ba71V strain of the Vesicular Stomatitis Virus (VSV), which belongs to the Rhabdoviridae family. The study of Ba71V-126 has garnered significant interest due to its potential relevance in the fields of virology, immunology, and vaccine development. VSV is an enveloped RNA virus that primarily infects livestock but can also affect humans. The Ba71V strain is particularly noteworthy for its ability to induce a strong immune response, making it a candidate for oncolytic virotherapy and a tool for studying viral pathogenesis. The recombinant protein Ba71V-126 is engineered to express specific viral proteins that can provoke an immune response without causing disease, thus serving as a safe model for research. Investigations into the structure, function, and immunogenicity of Ba71V-126 are crucial for understanding its mechanisms of action, as well as its potential application in developing live-attenuated vaccines or as an adjuvant in therapeutic interventions. Also, Ba71V-126 is being explored for its ability to facilitate targeted delivery of therapeutic agents in cancer treatment, reflecting a broader trend in utilizing viral vectors for innovative therapeutic solutions. The ongoing research focuses on optimizing the expression, purification, and characterization of Ba71V-126 to maximize its efficacy and safety as a candidate for future clinical applications.
