Cat: PA1000-1878

Recombinant Human MAGEB10 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MAGEB10

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SUOX;Sulfite oxidase. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96LZ2

  • Expression Region

    1-347aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMPRGQKSKLRAREKRRQARGGLEDLID ALDILEEEEESPPSASACLKDVFQSSLDGASNNPHGLREAQSTSTSATAA SHTRHPEGVNDQMEERPICTQDLEATDSFP RGPVDEKVIILVHYLLYKYQMKEPITKADMLRNVTQMSKSQFPVILSRAS EHLELIFGLDLKEVEPNKHIYVLVNKLDLGCDAKLSDETGVPKTGLLMTV LGIIFTNGNCVAEEEVWKVFNTMGLYDGIEHFMFGEPRKLLTKDLVKENY LEYQQVPNSDPPRYQFLWGPRAHAETSKMKVLEFLAKVNDTAPSEFSNWY TEALQDEEERARARVAAKAR VSATAGARSKVKSSKSSQLQ

  • Molecular Weight

    41 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MAGEB10 (Melanoma Antigen Gene B10) is a member of the MAGE family of genes, which are known for their roles in tumor immunology and cancer biology. Primarily expressed in the testis and various tumor tissues, MAGEB10 encodes a protein that is considered a promising target for cancer immunotherapy due to its immunogenic potential. The study of MAGEB10 and its recombinant protein has garnered significant interest in recent years, as it may elicit strong immune responses in cancer patients, making it a candidate for therapeutic vaccine development. Researchers have been exploring its expression patterns, functional roles in tumor progression, and potential utility in diagnostic and prognostic applications. By understanding the molecular mechanisms underlying MAGEB10's involvement in oncogenesis, scientists aim to leverage this knowledge to improve treatment strategies, specifically in melanoma and other malignancies. The development of MAGEB10-based recombinant proteins could lead to novel immunotherapeutic approaches, enhancing the immune system's ability to recognize and combat cancer cells effectively. Overall, the study of MAGEB10 represents a convergence of cancer biology, immunology, and biotechnology, with the potential to significantly impact cancer treatment paradigms.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US