Analytical Data
-
Gene name
MAGEA8
- Application
-
Alternative Names
MAGEA8;MAGE8;Melanoma-associated antigen 8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P43361
-
Expression Region
1-318aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMLLGQKSQRYKAEEGLQAQGEAPGLMD VQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASSSLTVTDS TLWSQSDEGSSSNEEEGPSTSPDPAHLESLFREALDEKVAELVRFLLRKY QIKEPVTKAEMLESVIKNYKNHFPDIFSKASECMQVIFGIDVKEVDPAGH SYILVTCLGLSYDGLLGDDQSTPKTGLLIIVLGMILMEGSRAPEEAIWEA LSVMGLYDGREHSVYWKLRKLLTQEWVQENYLEYRQAPGSDPVRYEFLWG PRALAETSYVKVLEHVVRVNARVRISYPSLHEEALGEEKGV
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAGEA8 (Melanoma Antigen Gene A8) is a member of the MAGE gene family, which is known for its role in tumor immunology and potential applications in cancer immunotherapy. Initially identified in melanoma, MAGEA8 is characterized by its expression in various tumors, but its presence in normal tissues is limited, making it an attractive target for cancer treatment. The study of MAGEA8 recombinant protein has gained attention due to its immunogenic properties, which can elicit a specific immune response against cancer cells expressing this antigen. Understanding the structure, function, and immunogenicity of MAGEA8 is crucial in developing therapeutic strategies, including cancer vaccines and adoptive T cell therapies. Additionally, research has indicated that MAGEA8 may be involved in the regulation of cell survival and proliferation, further highlighting its potential role in tumorigenesis. As interest in personalized medicine and targeted therapies grows, MAGEA8 serves as a promising candidate for the development of novel immunotherapeutic approaches aimed at harnessing the body’s immune system to combat cancer more effectively. Understanding the dynamics of MAGEA8 expression and its interaction with immune cells could provide valuable insights into enhancing anti-tumor responses, thereby advancing the field of cancer treatment. Hence, ongoing research into MAGEA8 recombinant protein not only contributes to the fundamental understanding of cancer biology but also paves the way for innovative therapeutic interventions in oncology.
