Analytical Data
-
Gene name
KLRC4
- Application
-
Alternative Names
KLRC4; NKG2F; NKG2-F type II integral membrane protein; NK cell receptor F; NKG2-F-activating NK receptor
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43908
-
Expression Region
1-158aa
-
AA Sequence
MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL
-
Molecular Weight
43.12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KLRC4, a member of the KLR (killer cell lectin-like receptor) family, plays a critical role in the immune response, particularly in the recognition and regulation of natural killer (NK) cells. Research on KLRC4 is of significant interest due to its potential implications in cancer immunotherapy and infectious disease management. This receptor, which is expressed on the surface of NK cells, interacts with specific ligands present on the surface of target cells, influencing NK cell activation, cytotoxicity, and overall immune surveillance. The structural and functional characterization of KLRC4 is essential for understanding its mechanisms of action and its role in immune regulation. Recombinant KLRC4 protein has been produced to facilitate in-depth studies regarding its binding affinity, signaling pathways, and interactions with ligands. Insights gained from these studies could lead to the development of novel therapeutic strategies aimed at enhancing NK cell activities against tumors or modulating immune responses in various diseases. Furthermore, exploring the genetic and epigenetic regulation of KLRC4 expression can reveal additional layers of complexity in its role within the immune system. Overall, the research surrounding KLRC4 recombinant protein underscores its importance in advancing our understanding of innate immunity and developing targeted immunotherapies.
