Analytical Data
-
Gene name
MARCKSL1
- Application
-
Alternative Names
MARCKSL1;MLP;MRP;MARCKS-related Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49006
-
Expression Region
1-195aa
-
AA Sequence
MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPTSQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE
-
Molecular Weight
46.5kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MARCKSL1 (myristoylated alanine-rich C kinase substrate-like protein 1) is a member of the MARCKS family of proteins, which are implicated in various cellular processes, including cytoskeletal organization, signal transduction, and membrane dynamics. Research has shown that MARCKSL1 plays a crucial role in modulating immune responses and cell adhesion, making it significant in the fields of immunology and cancer biology. Its myristoylation, a post-translational modification, facilitates its interaction with cellular membranes, influencing actin filament assembly and cellular motility. Recent studies have highlighted MARCKSL1's involvement in the modulation of inflammatory responses, particularly in macrophages, suggesting that it may play a role in autoimmune diseases and infections. Moreover, alterations in MARCKSL1 expression have been linked to various cancers, indicating its potential as a biomarker or therapeutic target. Understanding the molecular mechanisms underlying MARCKSL1 function and regulation is essential for elucidating its contribution to disease processes and developing novel therapeutic strategies. Thus, the recombinant protein of MARCKSL1 is increasingly being utilized in research to explore its functional roles, interactions, and potential applications in targeted therapies. As the scientific community continues to investigate the full-spectrum roles of MARCKSL1, it remains a promising candidate for further study in both basic and translational research settings.
