Analytical Data
-
Gene name
MFGE8
- Application
-
Alternative Names
MFGE8;Lactadherin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q08431
-
Expression Region
24-387aa
-
AA Sequence
LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC
-
Molecular Weight
56.8kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MFGE8 (Milk Fat Globule-EGF Factor 8) is a secreted glycoprotein that plays a crucial role in various biological processes, including cell adhesion, immune response, and tissue remodeling. Originally identified in the milk fat globule membrane, MFGE8 has attracted significant research interest due to its involvement in the clearance of apoptotic cells and its potential implications in inflammatory diseases, cancer progression, and tissue repair mechanisms. The protein binds to phosphatidylserine on the surface of apoptotic cells, facilitating their recognition and removal by macrophages through a receptor-mediated process. This function is critical in maintaining tissue homeostasis and preventing excessive inflammatory responses. In recent studies, recombinant MFGE8 has been produced to understand its structural properties, signaling pathways, and therapeutic potential. The generation of recombinant forms of MFGE8 enables researchers to investigate its functional roles in various cellular contexts and assess its efficacy in modulating immune responses and promoting tissue regeneration. As studies continue to unveil the diverse roles of MFGE8 in health and disease, the development of MFGE8-based therapeutic strategies holds promise for treating conditions such as autoimmune disorders, cancer, and chronic inflammatory diseases, underscoring the need for further research into its biological functions and clinical applications.











