Analytical Data
-
Gene name
SMURF1
- Application
-
Alternative Names
SMURF1；KIAA1625；E3 ubiquitin-Protein ligase SMURF1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HCE7
-
Expression Region
198-374aa
-
AA Sequence
VESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIPSPSGTIPGGDAAFLYEFLLQGHTSEPRDLNSVNCDELGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLHHIMNHQCQLKEPSQPLPLPSEGSLEDEELPAQRY
-
Molecular Weight
24.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SMURF1 (SMAD ubiquitination regulatory factor 1) is a member of the SMURF family of E3 ubiquitin ligases, which play critical roles in the regulation of various cellular processes, including cell signaling, proliferation, and apoptosis. Research on SMURF1 has gained prominence due to its involvement in several key signaling pathways, particularly the TGF-β (transforming growth factor-beta) superfamily. SMURF1 facilitates the ubiquitination and subsequent degradation of SMAD proteins, which are crucial mediators of TGF-β signaling. Dysregulation of SMURF1 has been implicated in various pathological conditions, including cancer metastasis and fibrosis, making it a potential therapeutic target. Furthermore, SMURF1 has been shown to interact with other signaling molecules, which adds complexity to its role in the cellular environment. Investigating the properties and functions of recombinant SMURF1 protein can provide insights into its mechanism of action and potential applications in biomedicine. By studying its structure, enzymatic activity, and interactions with other proteins, researchers aim to elucidate the precise contributions of SMURF1 to cellular homeostasis and disease progression. Understanding these mechanisms may pave the way for novel therapeutic strategies that leverage the modulation of SMURF1 activity in treating conditions associated with TGF-β signaling dysregulation.
