Analytical Data
-
Gene name
SAP3
- Application
-
Alternative Names
SAP3；Ganglioside GM2 activator
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P17900
-
Expression Region
32-193aa
-
AA Sequence
SSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI
-
Molecular Weight
33.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SAP3, or Sphingolipid Activator Protein 3, is a member of the saposin family, which plays a crucial role in the metabolism of sphingolipids. Sphingolipids are vital components of cellular membranes and are involved in various biological processes, including cell signaling, apoptosis, and cell recognition. Mutations or deficiencies in saposin proteins can lead to severe lysosomal storage disorders, highlighting the importance of studying these proteins. The characterization and understanding of SAP3's structure and function are essential for elucidating its role in sphingolipid metabolism and its implications in related diseases. Recent advancements in molecular biology techniques have enabled researchers to explore the protein's biochemical properties, interactions, and potential therapeutic targets. By investigating SAP3's reorganization and functional mechanisms, scientists aim to develop innovative strategies for treating sphingolipid-related disorders and improving our understanding of cellular lipid homeostasis. Understanding the dynamic nature of SAP3 and its contributions to cellular functions is critical for unlocking new avenues for therapeutic intervention in diseases associated with sphingolipid metabolism dysregulation.
