Cat: IPD-X13884

Recombinant Canine CXCL16 Protein(HEK293), C-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CXCL16

  • 简介

    CXCL16, also known as SR-PSOX (scavenger receptor that binds phosphatidylserine and oxidized lipoprotein), is one member of the ELR-negative CXC chemokine subfamily. CXCL16 is a multifunctional protein involved in various inflammatory diseases, atherosclerosis, and cancer. CXCL16 can be observed in many cell types[1][2]. CXCL16 Protein, Canine (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 205 amino acids (M1-S205).

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Determined by its ability to chemoattract activated Jurkat cells. The ED50 for this effect is 0.9798 ng/mL, corresponding to a specific activity is 1.021×106 U/mg. Determined by its ability to chemoattract activated Jurkat cells. The ED50 for this effect is 0.9798 ng/mL, corresponding to a specific activity is 1.021×106 U/mg.

  • Alternative Names

    C-X-C motif chemokine 16; SR-PSOX; Srpsox; SCYB16; CXCL16

  • Species

    Canine

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    XP_849304.2

  • Expression Region

    N22-S205

  • AA Sequence

    NEGSVTGSCYCDKAISSGSPPTAELMAHLRKHLRVYQRCNSYVRFQLRMRSVCGGSKDPWVQQLMSCLDRKECGSADSRSVAPQEQLPPLSTQVPEPTERAPLDMGSPAQTYLPPAWRSTYLPTALQSTRQPVFPAGTLSLEKKLTHTSEIATSTVGHSLRTGSEAGESQKQQIKRVEPTAGTS

  • Protein Length

    Partial

  • Molecular Weight

    30-55 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CXCL16, a chemokine belonging to the CXC family, plays a critical role in immune response and inflammation. It acts as a ligand for the receptor CXCR6 and is unique in its dual function, serving both as a chemokine and an adhesion molecule. Research has shown that CXCL16 is involved in various physiological and pathological processes, including immune cell migration, atherosclerosis, and cancer metastasis. Its expression is upregulated in response to inflammatory stimuli, making it a key player in autoimmune diseases and chronic inflammation. Understanding the structure and function of CXCL16 through recombinant protein studies provides valuable insights into its signaling mechanisms and interactions with leukocytes. This knowledge can pave the way for therapeutic interventions targeting CXCL16 in inflammatory diseases and malignancies. Thus, the production and characterization of CXCL16 recombinant protein are essential for elucidating its biological functions and exploring potential clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US