Analytical Data
-
Gene name
CXCL16
-
简介
CXCL16, also known as SR-PSOX (scavenger receptor that binds phosphatidylserine and oxidized lipoprotein), is one member of the ELR-negative CXC chemokine subfamily. CXCL16 is a multifunctional protein involved in various inflammatory diseases, atherosclerosis, and cancer. CXCL16 can be observed in many cell types[1][2]. CXCL16 Protein, Canine (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 205 amino acids (M1-S205).
- Application
-
Biological Activity
Determined by its ability to chemoattract activated Jurkat cells. The ED50 for this effect is 0.9798 ng/mL, corresponding to a specific activity is 1.021×106 U/mg. Determined by its ability to chemoattract activated Jurkat cells. The ED50 for this effect is 0.9798 ng/mL, corresponding to a specific activity is 1.021×106 U/mg.
-
Alternative Names
C-X-C motif chemokine 16; SR-PSOX; Srpsox; SCYB16; CXCL16
-
Species
Canine
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
XP_849304.2
-
Expression Region
N22-S205
-
AA Sequence
NEGSVTGSCYCDKAISSGSPPTAELMAHLRKHLRVYQRCNSYVRFQLRMRSVCGGSKDPWVQQLMSCLDRKECGSADSRSVAPQEQLPPLSTQVPEPTERAPLDMGSPAQTYLPPAWRSTYLPTALQSTRQPVFPAGTLSLEKKLTHTSEIATSTVGHSLRTGSEAGESQKQQIKRVEPTAGTS
-
Protein Length
Partial
-
Molecular Weight
30-55 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CXCL16, a chemokine belonging to the CXC family, plays a critical role in immune response and inflammation. It acts as a ligand for the receptor CXCR6 and is unique in its dual function, serving both as a chemokine and an adhesion molecule. Research has shown that CXCL16 is involved in various physiological and pathological processes, including immune cell migration, atherosclerosis, and cancer metastasis. Its expression is upregulated in response to inflammatory stimuli, making it a key player in autoimmune diseases and chronic inflammation. Understanding the structure and function of CXCL16 through recombinant protein studies provides valuable insights into its signaling mechanisms and interactions with leukocytes. This knowledge can pave the way for therapeutic interventions targeting CXCL16 in inflammatory diseases and malignancies. Thus, the production and characterization of CXCL16 recombinant protein are essential for elucidating its biological functions and exploring potential clinical applications.











