Analytical Data
-
Gene name
Ush2A
- Application
-
Alternative Names
Ush2A；Usherin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q2QI47
-
Expression Region
265-517aa
-
AA Sequence
GRMQDFRLYNVSLTNREILEVFSGDFPHLHIQPHCRCPGSHPRVHPSVQQYCIPNGAGDTPEHRMSRLNPEAHPLSFINDDDVATSWISHVFTNITQLYEGVAISIDLENGQYQVLKVITQFSSLQPVAIRIQRKKADSSPWEDWQYFARNCSVWGMKDNEDLENPNSVNCLQLPDFIPFSHGNVTFDLLTSGQKHRPGYNDFYNSSVLQEFMRATQIRLHFHGQYYPAGHTVDWRHQYYAVDEIIVSGRCQC
-
Molecular Weight
33.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Ush2A (USH2A) is a gene that encodes a protein critical for the function of photoreceptors in the retina, and its mutations have been implicated in Usher syndrome type II, a condition characterized by combined deafness and progressive vision loss. The Ush2A protein plays a vital role in the maintenance of the structure and function of sensory cells, specifically inner and outer photoreceptors. Given the high prevalence of Ush2A mutations in patients with inherited retinal diseases, there is a growing interest in studying Ush2A as a potential target for gene therapy and regenerative medicine. Researchers are exploring recombinant Ush2A protein to better understand its biological functions and interactions within the cell, as well as the pathophysiological mechanisms underlying Usher syndrome. Studies involving Ush2A protein aim to elucidate its role in phototransduction and cellular signaling pathways, which may provide insights into therapeutic approaches for restoring vision in affected individuals. The development of Ush2A-derived recombinant proteins also holds promise for screening potential small molecules or treatments that could mitigate the effects of Ush2A mutations. As such, the research surrounding Ush2A not only enhances our understanding of genetic causes of blindness but also pushes the frontier of therapeutic innovations in the field of ophthalmology and genetics.
