Analytical Data
-
Gene name
nanA
- Application
-
Alternative Names
nanA；Aspartic Proteinase NANA. chloroplast
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q0SWI8
-
Expression Region
1-288aa
-
AA Sequence
MKGIYSALLVSFDKDGNINEKGLREIIRHNIDVCKIDGLYVGGSTGENFMLSTDEKKRIFEIAMDEAKGQVKLIAQVGSVNLKEAVELAKFTTDLGYDAISAVTPFYYKFDFNEIKHYYETIINSVDNKLIIYSIPFLTGVNMSIEQFAELFENDKIIGVKFTAADFYLLERMRKAFPDKLIFAGFDEMMLPATVLGVDGAIGSTFNVNGIRARQIFEAAQKGDIETALEVQHVTNDLITDILNNGLYQTIKLILQEQGVDAGYCRQPMKEATEEMIEKAKEINKKYF
-
Molecular Weight
34.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NanA, a neuraminidase enzyme, plays a crucial role in the human pathogen *Streptococcus pneumoniae*, which is responsible for serious infections such as pneumonia, meningitis, and sepsis. This enzyme facilitates the cleavage of sialic acid residues from glycoproteins and glycolipids on host cells, aiding bacterial colonization and immune evasion. Research on NanA has gained prominence due to its potential as a target for vaccine development and antimicrobial therapies. Given the rise of antibiotic-resistant strains of *S. pneumoniae*, understanding the structure, function, and enzymatic mechanisms of NanA is essential. The recombinant expression of NanA protein allows for detailed biochemical characterization and the assessment of its immunogenic properties. Furthermore, studying NanA provides insights into the broader family of neuraminidases, contributing to the understanding of their roles in bacterial pathogenesis and interaction with the host. Establishing the recombinant NanA protein can also facilitate high-throughput screening for small molecule inhibitors and may lead to novel therapeutic approaches against pneumococcal infections. Overall, research on recombinant NanA not only contributes to the field of microbiology and immunology but also holds promise for improving clinical outcomes in patients affected by *Streptococcus pneumoniae* infections.
