Analytical Data
-
Gene name
NCS1
- Application
-
Alternative Names
NCS1;FLUP;FREQ;Neuronal calcium sensor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P62166
-
Expression Region
1-190aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMGKSNSKLKPEVVEELTRKTYFTEKEV QQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKD GRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDA IYQMVGNTVELPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADP SIVQALSLYDGLV
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NCS1, also known as neuronal calcium sensor 1, is a member of the calcium-binding protein family that plays a critical role in neuronal signaling and synaptic function. It is predominantly expressed in the brain and is involved in the modulation of neurotransmitter release, dendritic growth, and synaptic plasticity by interacting with various partners, including ion channels and other signaling proteins. Research on NCS1 has gained momentum due to its potential implications in understanding neurodegenerative diseases, psychiatric disorders, and synaptic dysfunction. Studies have shown that dysregulation of NCS1 levels and activity can affect calcium homeostasis and neuronal excitability, making it a candidate for exploring novel therapeutic strategies. Furthermore, the expression of NCS1 is influenced by various physiological stimuli and environmental factors, highlighting its role in adaptive responses within the nervous system. The recombinant production of NCS1 protein enables detailed investigations into its structural and functional properties, facilitating the exploration of its biological functions and interactions in cellular models. This is crucial for deciphering the molecular mechanisms underlying NCS1-related pathologies and identifying potential drug targets for neurological conditions. As research continues to unfold, NCS1 remains a significant focus for understanding the complexities of neuronal communication and the intricate regulation of calcium signaling in health and disease.











