Cat: PA1000-2104

Recombinant Human NCR3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NCR3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NCR3;1C7;LY117;Natural cytotoxicity triggering receptor 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O14931

  • Expression Region

    19-135aa

  • AA Sequence

    LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRN GTPEFRGRLA PLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLG VGTGNGTRLVVEKEHPQLG

  • Molecular Weight

    40 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Nuclear receptor corepressor 3 (NCR3), a member of the nuclear receptor corepressor family, plays a critical role in the regulation of gene expression by interacting with nuclear receptors and other transcription factors. The study of NCR3 has gained attention due to its involvement in various physiological processes and pathological conditions, including cancer, metabolic disorders, and neurodegenerative diseases. NCR3 functions primarily by mediating transcriptional repression, which is essential for maintaining cellular homeostasis. Dysregulation of NCR3 expression or function can lead to aberrant gene expression patterns, contributing to disease progression. Recent advances in molecular biology techniques, including CRISPR/Cas9 and high-throughput sequencing, have enabled researchers to explore the precise mechanisms by which NCR3 influences transcriptional networks. Furthermore, the identification of NCR3's interactions with specific ligands and co-factors has opened new avenues for therapeutic interventions. Understanding the functional dynamics of NCR3 in different cellular contexts is crucial for developing targeted treatments that harness its repressive capabilities. This research area holds promise for uncovering novel biomarkers and therapeutic targets, particularly in cancer where transcriptional dysregulation is a hallmark. As ongoing studies continue to elucidate the multifaceted roles of NCR3, it is anticipated that insights gained will contribute significantly to our understanding of gene regulation and its implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US