Analytical Data
-
Gene name
LOC342897
- Application
-
Alternative Names
Gm163; LOC342897; NCCRP 1; NCCRP1; NCRP1_HUMAN; Non specific cytotoxic cell receptor protein 1 homolog (zebrafish) ; Non specific cytotoxic cell receptor protein 1 homolog; Non-specific cytotoxic cell receptor protein 1 homolog
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6ZVX7
-
Expression Region
1-275aa
-
AA Sequence
MEEVREGHALGGGMEADGPASLQELPPSPRSPSPPPSPPPLPSPPSLPSPAAPEAPELPEPAQPSEAHARQLLLEEWGPLSGGLELPQRLTWKLLLLRRPLYRNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLLAEGLWEELLDDEQPAITVMDWFEDSRLDACVYELHVWLLAADRRTVIAQHHVAPRTSGRGPPGRWVQVSHVFRHYGPGVRFIHFLHKAKNRMEPGGLRRTRVTDSSVSVQLRE
-
Molecular Weight
57.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LOC342897 is a protein-coding gene that has garnered attention in recent years due to its potential roles in various biological processes and diseases. This gene is located on chromosome 9 and is known to produce a protein that may be involved in cellular signaling pathways, though its exact functions are still not fully understood. Initial investigations into LOC342897 have suggested its implications in metabolic regulation and the immune response, which has raised questions about its involvement in conditions such as obesity, diabetes, and autoimmune disorders. The development of recombinant LOC342897 protein has facilitated various studies, enabling researchers to explore its structural characteristics, functional roles, and interactions with other biomolecules. This recombinant protein serves as a valuable tool in elucidating the gene's role in physiological and pathological contexts, providing insights that could lead to innovative therapeutic strategies. Understanding LOC342897's functions could pave the way for advancements in precision medicine, especially in tackling complex diseases where this protein could play a crucial role. Due to its emerging significance, further research is warranted to identify potential biomarkers for disease detection and therapeutic targets involving LOC342897.
