Analytical Data
-
Gene name
LOC285141
- Application
-
Alternative Names
ERICH2Glutamate-rich protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A1L162
-
Expression Region
1-156aa
-
AA Sequence
METVNEPETGEVSKDAVIVKQEKNNEYCLQDIDDKLSESAEDDGEDDTNDEDDDEDSNPKKNTQAPLELMAEFLRAEMAREYQLAKKLCQMILIYEPENPEAKEFFTLIEEMLLMEKTQNHEQDGENSDEDSSGESKGESDEELSDESSDEGEDGS
-
Molecular Weight
44.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LOC285141, a long non-coding RNA (lncRNA), has garnered increasing attention in the field of molecular biology due to its potential roles in gene regulation and disease pathogenesis. Located on chromosome 2, LOC285141's precise biological functions remain largely unexplored, although emerging evidence suggests its involvement in various cellular processes, including cell proliferation, apoptosis, and differentiation. Research indicates that lncRNAs, including LOC285141, can interact with chromatin-modifying complexes and transcription factors, ultimately influencing the expression of neighboring genes. The aberrant expression of LOC285141 has been linked to several pathological conditions, including cancer, where it may contribute to tumor progression and metastasis. Therefore, understanding the mechanisms through which LOC285141 exerts its effects at the molecular level is crucial for elucidating its role in both normal physiology and disease states. Recent studies have begun to explore the potential of LOC285141 as a biomarker for diagnosis and prognosis, as well as a therapeutic target. The ability to produce recombinant proteins related to LOC285141 may facilitate further research into its functional properties, interactions, and effects on cellular behavior. By better delineating the roles of this lncRNA, researchers aim to uncover novel insights into gene regulation and develop strategies for targeted interventions in diseases associated with its dysregulation. Overall, the study of LOC285141 represents a promising frontier in the genomic landscape, emphasizing the importance of non-coding RNAs in human health and disease.
