Analytical Data
-
Gene name
BTNL2
- Application
-
Alternative Names
BTNL2;Butyrophilin-like Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UIR0
-
Expression Region
1-455aa
-
AA Sequence
MVDFPGYNLSGAVASFLFILLTMKQSEDFRVIGPAHPILAGVGEDALLTCQLLPKRTTMHVEVRWYRSEPSTPVFVHRDGVEVTEMQMEEYRGWVEWIENGIAKGNVALKIHNIQPSDNGQYWCHFQDGNYCGETSLLLKVAGLGSAPSIHMEGPGESGVQLVCTARGWFPEPQVYWEDIRGEKLLAVSEHRIQDKDGLFYAEATLVVRNASAESVSCLVHNPVLTEEKGSVISLPEKLQTELASLKVNGPSQPILVRVGEDIQLTCYLSPKANAQSMEVRWDRSHRYPAVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQEASLDLKVVSLGSSPLITVEGQEDGEMQPMCSSDGWFPQPHVPWRDMEGKTIPSSSQALTQGSHGLFHVQTLLRVTNISAVDVTCSISIPFLGEEKIATFSLSGW
-
Molecular Weight
53.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BTNL2, or butyrophilin-like 2, is a member of the butyrophilin family of genes, which are known for their roles in immune modulation and interaction with immune cells. Research has increasingly focused on BTNL2 due to its involvement in various autoimmune diseases, including rheumatoid arthritis and type 1 diabetes, as well as its potential influence on T cell activation and regulation. Recent studies suggest that BTNL2 may play a crucial role in maintaining immune homeostasis by modulating the activity of T cells, specifically through its interactions with the T cell receptor (TCR). The protein's structure features immunoglobulin-like domains that are believed to participate in ligand-receptor interactions affecting immune responses. Given its significance in immunological processes, the recombinant expression of BTNL2 protein offers a valuable tool for exploring its functional mechanisms and therapeutic potential. Understanding the molecular pathways involving BTNL2 could lead to novel strategies for targeting immune-related disorders. Consequently, researchers are increasingly interested in characterizing the physiological roles of BTNL2 and its potential as a biomarker or therapeutic target in the context of immune regulation and disease.











