Analytical Data
-
Gene name
GPR15
- Application
-
Alternative Names
GPR15；G-Protein coupled receptor 15
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49685
-
Expression Region
1-360aa
-
AA Sequence
MDPEETSVYLDYYYATSPNSDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHFKPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCSVLLLTCMSVDRYLAIVWPVVSRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDKPYCAEKKATPIKLIWSLVALIFTFFVPLLSIVTCYCCIARKLCAHYQQSGKHNKKLKKSIKIIFIVVAAFLVSWLPFNTFKFLAIVSGLRQEHYLPSAILQLGMEVSGPLAFANSCVNPFIYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFARRRKRSVSL
-
Molecular Weight
43.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR15, also known as G protein-coupled receptor 15, is an important receptor implicated in various physiological and pathological processes, including immune response and neurobiology. It is primarily recognized for its role in lymphocyte migration and homing, which is crucial for maintaining immune surveillance and tissue homeostasis. Research has shown that GPR15 is involved in the regulation of inflammation, as well as in the pathogenesis of several diseases, such as HIV infection and certain cancers. Given its significance in these areas, GPR15 has emerged as a potential therapeutic target. The development of recombinant GPR15 proteins is critical for studying the receptor's structure-function relationships, understanding its signaling mechanisms, and identifying novel ligand interactions. Additionally, these proteins can be used in drug discovery processes to develop GPR15 modulators that may aid in treating conditions associated with dysregulated immune responses. Overall, the exploration of GPR15 through recombinant protein research holds promise for advancing our understanding of its biological roles and therapeutic potential.
