Analytical Data
-
Gene name
NDUFA4
- Application
-
Alternative Names
NDUFA4;Cytochrome c oxidase subunit NDUFA4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00483
-
Expression Region
38-81aa
-
AA Sequence
LFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF
-
Molecular Weight
32.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NDUFA4, or NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 4, is a critical component of the mitochondrial respiratory chain, specifically involved in complex I, which is pivotal for ATP production through oxidative phosphorylation. Research into NDUFA4 has gained prominence due to its potential implications in various diseases, including neurodegenerative disorders and certain types of cancer. The protein's role in maintaining mitochondrial function and its involvement in cellular energy metabolism underscore its significance in health and disease. Moreover, NDUFA4 has been shown to interact with other protein complexes and may influence the balance between cell survival and apoptosis, making it a target of interest for therapeutic interventions. The recombinant production of NDUFA4 enables detailed structural and functional studies, allowing researchers to investigate its precise mechanism of action and its interactions within the respiratory chain. Understanding these aspects could provide insights into the pathogenic mechanisms underlying mitochondrial dysfunction and aid in the development of targeted therapies for diseases associated with impaired energy metabolism. The ongoing research aims to elucidate the role of NDUFA4 not only in mitochondrial bioenergetics but also in broader cellular contexts, thereby expanding our knowledge of its biological importance.
